Gene Mb2448c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSPOSASE [FIRST PART] |
| Comments | Mb2448c, -, len: 97 aa. Similar to 5' end of Rv2424c, len: 333 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 67 aa overlap). Probable transposase for IS1558, similar to IS element proteins e.g. AL021957|Rv2177c|MTV021_10 from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 1491, E(): 6.2e-87, (98.6% identity in 221 aa overlap); P19780|YIS1_STRCO HYPOTHETICAL INSERTION ELEMENT IS110 from Streptomyces coelicolor (45 aa), FASTA scores: opt: 203, E(): 1.7e-05; (27.3% identity in 238 aa overlap); etc. Contains PS01159 WW/rsp5/WWP domain signature. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2424c exists as a single gene. In Mycobacterium bovis, a frameshift due to a 2 bp deletion (gt-*) splits Rv2424c into 2 parts, Mb2447c and Mb2448c. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2689667 | 2689960 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2448c|Mb2448c
MQCRAREERPGRKTDLLDAEWLVHLLECGLLRGWLIPPADIKAARDVIRYRRKLVEHRTSKLQRLGNASRRRDQGRQRGVLGHPQVGAGDGGGAHRR
Bibliography
No article yet recorded