Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionRequired for the transposition of the insertion element IS1558.
ProductProbable transposase
CommentsRv2424c, (MTCY428.23), len: 333 aa. Probable transposase for IS1558, similar to is element proteins e.g. AL021957|Rv2177c|MTV021_10 from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 1491, E(): 6.2e-87, (98.6% identity in 221 aa overlap); P19780|YIS1_STRCO hypothetical insertion element IS110 from Streptomyces coelicolor (45 aa), FASTA scores: opt: 203, E(): 1.7e-05; (27.3% identity in 238 aa overlap); etc. Contains PS01159 WW/rsp5/WWP domain signature.
Functional categoryInsertion seqs and phages
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27207762721777-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2424c|Rv2424c
VQCRAREERPGRKTDLLDAEWLVHLLECGLLRGWLIPPADIKAARDVIRYRRKLVEHRTSKLQRLGNVLQDAGIKADSVASSVTPKSVRAMVEALIDGERRPAVLADLARGSMRSKIPDLQRALEGRFDDHHALMCRLHLAHLDQLDAMIGALDEQIEQLMHPFCARRELIASIPGIGVGASATVISEIGADPAAWFPSAEHLASWVRLCPGNHESAGKRHHGARRTGNQHLQPVLVECAWAAVRTDGYLREYYRRQVRKFGGFRSPAANKKAITTVAHKLIVIIWHVLATGRPHQDLGADYFTTRMDPDKERRRLVAKLEAQGLGVTLEPAA