Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in oxidative stress response. LPDC|Rv0462, DLAT|Rv2215, AHPD|Rv2429, and AHPC|Rv2428 constitute an NADH-dependent peroxidase and peroxynitrite reductase that provides protection against oxidative stress.
ProductAlkyl hydroperoxide reductase C protein AhpC (alkyl hydroperoxidase C)
CommentsRv2428, (MTCY428.18c), len: 195 aa. AhpC, alkyl hydroperoxide reductase C (see citations below), equivalent to other alkyl hydroperoxide reductases C mycobacterial proteins e.g. Q9CBF5|AHPC|ML2042 alkyl hydroperoxide reductase from Mycobacterium leprae (195 aa) FASTA scores: opt: 1183, E(): 2.6e-72, (88.20% identity in 195 aa overlap); O87323|AHPC from Mycobacterium marinum (195 aa), FASTA scores: opt: 1215, E(): 1.9e-74, (90.8% identity in 195 aa overlap); Q57413|AHPC|AVI-3 from Mycobacterium avium (195 aa), FASTA scores: opt: 1201, E(): 1.6e-73, (90.25% identity in 195 aa overlap). Also highly similar to others from other organisms e.g. Q9FBP5|AHPC alkyl hydroperoxide reductase from Streptomyces coelicolor (184 aa), FASTA scores: opt: 768, E(): 1.7e-44, (62.45% identity in 189 aa overlap); etc.
Functional category-
ProteomicsIdentified in immunodominant fractions of M. tuberculosis H37Rv cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis (gene induced by hypoxia: see Sherman et al., 2001; gene induced by isoniazid (INH) or ethionamide treatment: see Wilson et al., 1999; gene induced by in vitro acid shock: see Fisher et al., 2002). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27261932726780+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2428|ahpC
MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA
      
Bibliography