Gene Rv2428
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in oxidative stress response. LPDC|Rv0462, DLAT|Rv2215, AHPD|Rv2429, and AHPC|Rv2428 constitute an NADH-dependent peroxidase and peroxynitrite reductase that provides protection against oxidative stress. |
| Product | Alkyl hydroperoxide reductase C protein AhpC (alkyl hydroperoxidase C) |
| Comments | Rv2428, (MTCY428.18c), len: 195 aa. AhpC, alkyl hydroperoxide reductase C (see citations below), equivalent to other alkyl hydroperoxide reductases C mycobacterial proteins e.g. Q9CBF5|AHPC|ML2042 alkyl hydroperoxide reductase from Mycobacterium leprae (195 aa) FASTA scores: opt: 1183, E(): 2.6e-72, (88.20% identity in 195 aa overlap); O87323|AHPC from Mycobacterium marinum (195 aa), FASTA scores: opt: 1215, E(): 1.9e-74, (90.8% identity in 195 aa overlap); Q57413|AHPC|AVI-3 from Mycobacterium avium (195 aa), FASTA scores: opt: 1201, E(): 1.6e-73, (90.25% identity in 195 aa overlap). Also highly similar to others from other organisms e.g. Q9FBP5|AHPC alkyl hydroperoxide reductase from Streptomyces coelicolor (184 aa), FASTA scores: opt: 768, E(): 1.7e-44, (62.45% identity in 189 aa overlap); etc. |
| Functional category | - |
| Proteomics | Identified in immunodominant fractions of M. tuberculosis H37Rv cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia: see Sherman et al., 2001; gene induced by isoniazid (INH) or ethionamide treatment: see Wilson et al., 1999; gene induced by in vitro acid shock: see Fisher et al., 2002). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2726193 | 2726780 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2428|ahpC
MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA
Bibliography
- Deretic V et al. [1995]. Mycobacterium tuberculosis is a natural mutant with an inactivated oxidative-stress regulatory gene: implications for sensitivity to isoniazid. Regulation
- Wilson TM et al. [1996]. ahpC, a gene involved in isoniazid resistance of the Mycobacterium tuberculosis complex. Sequence Regulation
- Heym B et al. [1997]. Effects of overexpression of the alkyl hydroperoxide reductase AhpC on the virulence and isoniazid resistance of Mycobacterium tuberculosis. Secondary Mutant
- Wilson M, DeRisi J, Kristensen HH, Imboden P, Rane S, Brown PO and Schoolnik GK [1999]. Exploring drug-induced alterations in gene expression in Mycobacterium tuberculosis by microarray hybridization. Regulation
- Sherman DR et al. [1999]. AhpC, oxidative stress and drug resistance in Mycobacterium tuberculosis. Review
- Springer B et al. [2001]. Silencing of oxidative stress response in Mycobacterium tuberculosis: expression patterns of ahpC in virulent and avirulent strains and effect of ahpC inactivation. Mutant
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Domenech P, Honore N, Heym B and Cole ST [2001]. Role of OxyS of Mycobacterium tuberculosis in oxidative stress: overexpression confers increased sensitivity to organic hydroperoxides. Secondary Regulation
- Pym AS et al. [2001]. Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis. Secondary Regulation
- Chauhan R et al. [2001]. Characterization of the Mycobacterium tuberculosis H37Rv alkyl hydroperoxidase AhpC points to the importance of ionic interactions in oligomerization and activity. Product Biochemistry Function
- Covert BA et al. [2001]. The application of proteomics in defining the T cell antigens of Mycobacterium tuberculosis. Proteomics
- Chauhan R et al. [2002]. Site-directed mutagenesis reveals a novel catalytic mechanism of Mycobacterium tuberculosis alkylhydroperoxidase C. Function Mutant
- Master SS et al. [2002]. Oxidative stress response genes in Mycobacterium tuberculosis: role of ahpC in resistance to peroxynitrite and stage-specific survival in macrophages. Mutant Function
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Bryk R et al. [2002]. Metabolic enzymes of mycobacteria linked to antioxidant defense by a thioredoxin-like protein. Function
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Transcriptome
- GuimarĂ£es BG et al. [2005]. Structure and mechanism of the alkyl hydroperoxidase AhpC, a key element of the Mycobacterium tuberculosis defense system against oxidative stress. Structure
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant