Gene Rv2437
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved transmembrane protein |
| Comments | Rv2437, (MTCY428.09c), len: 139 aa. Conserved transmembrane protein, with some similarity to conserved hypothetical proteins e.g. O06539|RV1139C|MTCI65.06c from Mycobacterium tuberculosis (166 aa); AAK45430|MT1172 from Mycobacterium tuberculosis (124 aa), FASTA scores: opt: 166, E(): 0.00013, (35.7% identity in 112 aa overlap); BAB48937|Mlr1600 from Rhizobium loti (222 aa), FASTA scores: opt: 163 ,E(): 0.00033, (28.1% identity in 121 aa overlap); etc. Contains membrane spanning regions. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2734376 | 2734795 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2437|Rv2437
VLQRTNVVQPLNTLRMVWIQVAGIIPATAGIAATVYAQLAMGDSWRIGVDEQENTTLVRTGPFKWVRHPIYTAMMAFGLGLLLVTPNLVALAGFILLVATLEVHVRRVEEPYLLRTHSAVYRGYTASVGRFVPGVGLIR
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
