Gene Mb2463
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved transmembrane protein |
| Comments | Mb2463, -, len: 139 aa. Equivalent to Rv2437, len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Conserved hypothetical protein, with some similarity to CONSERVED HYPOTHETICAL PROTEINS e.g. O06539|RV1139C|MTCI65.06c from Mycobacterium tuberculosis (166 aa); AAK45430|MT1172 from Mycobacterium tuberculosis (124 aa), FASTA scores: opt: 166, E(): 0.00013, (35.7% identity in 112 aa overlap); BAB48937|Mlr1600 from Rhizobium loti (222 aa), FASTA scores: opt: 163 ,E(): 0.00033, (28.1% identity in 121 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2702539 | 2702958 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2463|Mb2463
MLQRTNVVQPLNTLRMVWIQVAGIIPATAGIAATVYAQLAMGDSWRIGVDEQENTTLVRTGPFKWVRHPIYTAMMAFGLGLLLVTPNLVALAGFILLVATLEVHVRRVEEPYLLRTHSAVYRGYTASVGRFVPGVGLIR
Bibliography
No article yet recorded