Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMajor role in the synthesis of nucleoside triphosphates other than ATP [catalytic activity: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate].
ProductProbable nucleoside diphosphate kinase NdkA (NDK) (NDP kinase) (nucleoside-2-P kinase)
CommentsRv2445c, (MTV008.01c, MTCY428.01), len: 136 aa. Probable ndkA (alternate gene name: ndk), nucleoside diphosphate kinase, equivalent to Q9CBZ0|NDK|ML1469 from Mycobacterium leprae (136 aa), FASTA scores: opt: 762, E(): 1.5e-42, (87.4% identity in 135 aa overlap); and O85501|NDK from Mycobacterium smegmatis (139 aa), FASTA scores: opt: 714, E(): 1.9e-39, (80.7% identity in 135 aa overlap). Also highly similar to others e.g. P50589|NDK_STRCO from Streptomyces coelicolor (137 aa), FASTA scores: opt: 535, 6.8e-28, (60.3% identity in 136 aa overlap); O29491|NDK_ARCFU|AF0767 from Archaeoglobus fulgidus (151 aa), FASTA scores: opt: 521, E(): 5.9e-27, (58.0% identity in 131 aa overlap); P31103|NDK_BACSU from Bacillus subtilis (151 aa), FASTA scores: opt: 515, E(): 1.4e-26, (56.5% identity in 131 aa overlap); etc. Belongs to the NDK family. Ppk2|Rv3232c and NdkA|Rv2445c interact (See Sureka et al., 2009).
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 5_98 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and also identified in cytosol by proteomics at the Statens Serum Institute (Denmark) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27453142745724-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2445c|ndkA
VTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
      
Bibliography