Gene Rv2445c (ndk)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Major role in the synthesis of nucleoside triphosphates other than ATP [catalytic activity: ATP + nucleoside diphosphate = ADP + nucleoside triphosphate]. |
| Product | Probable nucleoside diphosphate kinase NdkA (NDK) (NDP kinase) (nucleoside-2-P kinase) |
| Comments | Rv2445c, (MTV008.01c, MTCY428.01), len: 136 aa. Probable ndkA (alternate gene name: ndk), nucleoside diphosphate kinase, equivalent to Q9CBZ0|NDK|ML1469 from Mycobacterium leprae (136 aa), FASTA scores: opt: 762, E(): 1.5e-42, (87.4% identity in 135 aa overlap); and O85501|NDK from Mycobacterium smegmatis (139 aa), FASTA scores: opt: 714, E(): 1.9e-39, (80.7% identity in 135 aa overlap). Also highly similar to others e.g. P50589|NDK_STRCO from Streptomyces coelicolor (137 aa), FASTA scores: opt: 535, 6.8e-28, (60.3% identity in 136 aa overlap); O29491|NDK_ARCFU|AF0767 from Archaeoglobus fulgidus (151 aa), FASTA scores: opt: 521, E(): 5.9e-27, (58.0% identity in 131 aa overlap); P31103|NDK_BACSU from Bacillus subtilis (151 aa), FASTA scores: opt: 515, E(): 1.4e-26, (56.5% identity in 131 aa overlap); etc. Belongs to the NDK family. Ppk2|Rv3232c and NdkA|Rv2445c interact (See Sureka et al., 2009). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | The product of this CDS corresponds to spot 5_98 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and also identified in cytosol by proteomics at the Statens Serum Institute (Denmark) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2745314 | 2745724 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2445c|ndkA
VTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
Bibliography
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Chen Y et al. [2002]. X-ray structure of Mycobacterium tuberculosis nucleoside diphosphate kinase. Structure
- Chopra P et al. [2003]. Cytotoxic activity of nucleoside diphosphate kinase secreted from Mycobacterium tuberculosis. Product Biochemistry Secretion Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Sureka K et al. [2009]. Polyphosphate kinase 2: a modulator of nucleoside diphosphate kinase activity in mycobacteria. Biochemistry
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant