Gene Rv2465c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Interconverts ribose-5-phosphate and ribulose-5-phosphate |
| Product | Ribose-5-phosphate isomerase |
| Comments | Rv2465c, (MTV008.21c), len: 162 aa. RpiB, Ribose-5-phosphate isomerase, proven biochemically (see Roos et al., 2004) equivalent to AAK46840|MT2540 putative carbohydrate-phosphate isomerase from Mycobacterium tuberculosis strain CDC1551 (159 aa). Equivalent to Q9CBY1|ML1484 possible phosphopentose isomerase from Mycobacterium leprae (162 aa), FASTA scores: opt: 992, E(): 7.1e-59, (89.5% identity in 162 aa overlap). Also highly similar or similar to several diverse isomerases e.g. Q9L206|SC8E4.02c putative isomerase from Streptomyces coelicolor (159 aa), FASTA scores: opt: 661, E(): 6.1e-37, (61.45% identity in 153 aa overlap); P47636|Y396_MYCGE|MG396 hypothetical LACA/RPIB family protein from Mycoplasma genitalium (152 aa), FASTA scores: opt: 357, E(): 8.2e-17, (42% identity in 150 aa overlap); P53527|Y396_MYCPN|MPN595|MP247 hypothetical LACA/RPIB family protein from Mycoplasma pneumoniae (152 aa), FASTA scores: opt: 340, E(): 1.1e-15, (38.6% identity in 145 aa overlap); P26592|LACB_STAAU galactose-6-phosphate isomerase from Staphylococcus aureus (171 aa), FASTA scores: opt: 296, E(): 1e-12, (35.4% identity in 158 aa overlap) and P37351|RPIB_ECOLI ribose 5-phosphate isomerase b from Escherichia coli (149 aa), FASTA scores: opt: 262, E(): 1.6e-10, (32.2% identity in 146 aa overlap); etc. Could belong to the LACA/RPIB family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2767671 | 2768159 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2465c|rpiB
MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Roos AK et al. [2004]. Mycobacterium tuberculosis ribose-5-phosphate isomerase has a known fold, but a novel active site. Biochemistry
- Roos AK et al. [2005]. Competitive inhibitors of Mycobacterium tuberculosis ribose-5-phosphate isomerase B reveal new information about the reaction mechanism. Structure
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Roos AK et al. [2008]. D-ribose-5-phosphate isomerase B from Escherichia coli is also a functional D-allose-6-phosphate isomerase, while the Mycobacterium tuberculosis enzyme is not. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant