Gene Mb2492c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ribose-5-phosphate isomerase |
| Comments | Mb2492c, -, len: 162 aa. Equivalent to Rv2465c,len: 162 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 162 aa overlap). Probable isomerase (EC 5.-.-.-), equivalent to AAK46840|MT2540 PUTATIVE CARBOHYDRATE-PHOSPHATE ISOMERASE from Mycobacterium tuberculosis strain CDC1551 (159 aa). Equivalent to Q9CBY1|ML1484 POSSIBLE PHOSPHOPENTOSE ISOMERASE from M. leprae (162 aa), FASTA scores: opt: 992, E(): 7.1e-59,(89.5% identity in 162 aa overlap). Also highly similar or similar to several diverse isomerases e.g. Q9L206|SC8E4.02c PUTATIVE ISOMERASE from Streptomyces coelicolor (159 aa), FASTA scores: opt: 661, E(): 6.1e-37,(61.45% identity in 153 aa overlap); P47636|Y396_MYCGE|MG396 HYPOTHETICAL LACA/RPIB FAMILY PROTEIN from Mycoplasma genitalium (152 aa), FASTA scores: opt: 357, E(): 8.2e-17, (42% identity in 150 aa overlap); P53527|Y396_MYCPN|MPN595|MP247 HYPOTHETICAL LACA/RPIB FAMILY PROTEIN from Mycoplasma pneumoniae (152 aa), FASTA scores: opt: 340, E(): 1.1e-15, (38.6% identity in 145 aa overlap); P26592|LACB_STAAU galactose-6-phosphate isomerase from Staphylococcus aureus (171 aa), FASTA scores: opt: 296, E(): 1e-12, (35.4% identity in 158 aa overlap) and P37351|RPIB_ECOLI ribose 5-phosphate isomerase b from Escherichia coli (149 aa), FASTA scores: opt: 262, E(): 1.6e-10, (32.2% identity in 146 aa overlap); etc. COULD BELONG TO THE LACA/RPIB FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2735834 | 2736322 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2492c|rpib
MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
Bibliography
No article yet recorded
