Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInterconverts ribose-5-phosphate and ribulose-5-phosphate
ProductRibose-5-phosphate isomerase
CommentsRv2465c, (MTV008.21c), len: 162 aa. RpiB, Ribose-5-phosphate isomerase, proven biochemically (see Roos et al., 2004) equivalent to AAK46840|MT2540 putative carbohydrate-phosphate isomerase from Mycobacterium tuberculosis strain CDC1551 (159 aa). Equivalent to Q9CBY1|ML1484 possible phosphopentose isomerase from Mycobacterium leprae (162 aa), FASTA scores: opt: 992, E(): 7.1e-59, (89.5% identity in 162 aa overlap). Also highly similar or similar to several diverse isomerases e.g. Q9L206|SC8E4.02c putative isomerase from Streptomyces coelicolor (159 aa), FASTA scores: opt: 661, E(): 6.1e-37, (61.45% identity in 153 aa overlap); P47636|Y396_MYCGE|MG396 hypothetical LACA/RPIB family protein from Mycoplasma genitalium (152 aa), FASTA scores: opt: 357, E(): 8.2e-17, (42% identity in 150 aa overlap); P53527|Y396_MYCPN|MPN595|MP247 hypothetical LACA/RPIB family protein from Mycoplasma pneumoniae (152 aa), FASTA scores: opt: 340, E(): 1.1e-15, (38.6% identity in 145 aa overlap); P26592|LACB_STAAU galactose-6-phosphate isomerase from Staphylococcus aureus (171 aa), FASTA scores: opt: 296, E(): 1e-12, (35.4% identity in 158 aa overlap) and P37351|RPIB_ECOLI ribose 5-phosphate isomerase b from Escherichia coli (149 aa), FASTA scores: opt: 262, E(): 1.6e-10, (32.2% identity in 146 aa overlap); etc. Could belong to the LACA/RPIB family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27676712768159-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2465c|rpiB
MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
      
Bibliography