Gene Rv2466c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown. Seems regulated by sigh (Rv3223c product). |
| Product | Conserved protein |
| Comments | Rv2466c, (MTV008.22c), len: 207 aa. Conserved protein (see citation below), equivalent to Q9CBY0|ML1485 hypothetical protein from Mycobacterium leprae (207 aa), FASTA scores: opt: 1154, E(): 1.1e-67, (80.6% identity in 206 aa overlap). Also highly similar to Q9L201|SC8E4A.04c hypothetical protein from Streptomyces coelicolor (216 aa), FASTA scores: opt: 789, E(): 4.6e-44, (57.9% identity in 213 aa overlap). Also similar to AAK46628|MT2344 hypothetical protein from Mycobacterium tuberculosis strain CDC1551 (230 aa), FASTA scores: opt: 324, E(): 6.1e-14, (30.4% identity in 194 aa overlap). Contains PS00195 Glutaredoxin active site. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures (see Stewart et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2768261 | 2768884 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2466c|Rv2466c
MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD
Bibliography
- Paget MS et al. [2001]. Defining the disulphide stress response in Streptomyces coelicolor A3(2): identification of the sigmaR regulon. Homolog Sequence
- Raman S, Song T, Puyang X, Bardarov S, Jacobs Jr WR and Husson RN [2001]. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. Secondary Regulation
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
