Gene Mb2493c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2493c, -, len: 207 aa. Equivalent to Rv2466c,len: 207 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 207 aa overlap). Conserved hypothetical protein, equivalent to Q9CBY0|ML1485 HYPOTHETICAL PROTEIN from Mycobacterium leprae (207 aa),FASTA scores: opt: 1154, E(): 1.1e-67, (80.6% identity in 206 aa overlap). Also highly similar to Q9L201|SC8E4A.04c HYPOTHETICAL PROTEIN from Streptomyces coelicolor (216 aa), FASTA scores: opt: 789, E(): 4.6e-44, (57.9% identity in 213 aa overlap). Also similar to AAK46628|MT2344 HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis strain CDC1551 (230 aa), FASTA scores: opt: 324, E(): 6.1e-14, (30.4% identity in 194 aa overlap). Contains PS00195 Glutaredoxin active site. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2736424 | 2737047 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2493c|Mb2493c MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD
Bibliography
No article yet recorded