Gene Mb2493c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein | 
| Comments | Mb2493c, -, len: 207 aa. Equivalent to Rv2466c,len: 207 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 207 aa overlap). Conserved hypothetical protein, equivalent to Q9CBY0|ML1485 HYPOTHETICAL PROTEIN from Mycobacterium leprae (207 aa),FASTA scores: opt: 1154, E(): 1.1e-67, (80.6% identity in 206 aa overlap). Also highly similar to Q9L201|SC8E4A.04c HYPOTHETICAL PROTEIN from Streptomyces coelicolor (216 aa), FASTA scores: opt: 789, E(): 4.6e-44, (57.9% identity in 213 aa overlap). Also similar to AAK46628|MT2344 HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis strain CDC1551 (230 aa), FASTA scores: opt: 324, E(): 6.1e-14, (30.4% identity in 194 aa overlap). Contains PS00195 Glutaredoxin active site. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2736424 | 2737047 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb2493c|Mb2493c
MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD
      
    Bibliography
    No article yet recorded