Gene Rv2468A 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Conserved protein | 
| Comments | Rv2468A, len: 77 aa. Conserved protein. | 
| Functional category | Conserved hypotheticals | 
| Proteomics | Identified in cell lysates and/or culture filtrates of M. tuberculosis H37Rv (See Kelkar et al., 2011). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2772098 | 2772331 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2468A|Rv2468A
MEIHLFFVGIPLLLVVVLSVLIWSRKGPHPATYKLSEPWTHPPILWAATDEVVGSAHGGHGHDASEFTVGGGASGTW
      
    Bibliography
    - Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant