Gene Rv2470 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Oxygen carrier, involved in oxygen transport. | 
| Product | Globin (oxygen-binding protein) GlbO | 
| Comments | Rv2470, (MTV008.26), len: 128 aa. glbO, globin-like protein, highly similar to Q9CC59|GLBO|ML1253 hemoglobin-like (oxygen carrier) from Mycobacterium leprae (128 aa), FASTA scores: opt: 767, E(): 4e-47, (88.1% identity in 126 aa overlap); Q9X7B3|MLCB1610.14c putative globin from Mycobacterium leprae (131 aa); Q9L250|SC6D10.14 putative globin from Streptomyces coelicolor (137 aa), FASTA scores: opt: 466, E(): 5.7e-26, (53.6% identity in 125 aa overlap). Also similar to O31607 YJBI protein from Bacillus subtilis (132 aa), FASTA scores: opt: 294, E(): 6.6e-14; (39.85% identity in 128 aa overlap). Could belong to protozoan/cyanobacterial globin family protein. | 
| Functional category | Intermediary metabolism and respiration | 
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2773178 | 2773564 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2470|glbO
MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF
      
    Bibliography
    - Milani M et al. [2003]. A TyrCD1/TrpG8 hydrogen bond network and a TyrB10TyrCD1 covalent link shape the heme distal site of Mycobacterium tuberculosis hemoglobin O. Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Ouellet H et al. [2007]. The roles of Tyr(CD1) and Trp(G8) in Mycobacterium tuberculosis truncated hemoglobin O in ligand binding and on the heme distal site architecture. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant