Gene Mb2497
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | globin (oxygen-binding protein) glbo |
| Comments | Mb2497, glbO, len: 128 aa. Equivalent to Rv2470,len: 128 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 128 aa overlap). Possible glbO,globin-like protein, highly similar to Q9CC59|GLBO|ML1253 HEMOGLOBIN-LIKE (OXYGEN CARRIER) from Mycobacterium leprae (128 aa), FASTA scores: opt: 767, E(): 4e-47, (88.1% identity in 126 aa overlap); Q9X7B3|MLCB1610.14c PUTATIVE GLOBIN from Mycobacterium leprae (131 aa); Q9L250|SC6D10.14 PUTATIVE GLOBIN from Streptomyces coelicolor (137 aa), FASTA scores: opt: 466, E(): 5.7e-26,(53.6% identity in 125 aa overlap). Also similar to O31607 YJBI PROTEIN from Bacillus subtilis (132 aa), FASTA scores: opt: 294, E(): 6.6e-14; (39.85% identity in 128 aa overlap). COULD BELONG TO PROTOZOAN/CYANOBACTERIAL GLOBIN FAMILY PROTEIN. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2741341 | 2741727 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2497|glbO
MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF
Bibliography
No article yet recorded
