Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2472, (MTV008.28), len: 97 aa. Conserved hypothetical protein, showing some similarity to O53451|Rv1103c|MTV017.56c from Mycobacterium tuberculosis strain H37Rv (106 aa), FASTA scores: opt: 135, E(): 0.026, (45.85% identity in 72 aa overlap); and AAK45393|MT1135 hypothetical 11.4 KDA protein from Mycobacterium tuberculosis strain CDC1551 (78 aa) FASTA scores: opt: 139, E(): 0.011, (45.35% identity in 75 aa overlap).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS27752722775565+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2472|Rv2472
MMMRIAVRLPGEVITFVDSEVSQIRIPSRRAAVVLRASNASDAAILTATEPNHHLDALAGQAAKLAPTSIDAAHPARPARRDPCLYPRTGQALPRTG