Gene Rv2513 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Hypothetical protein | 
| Comments | Rv2513, (MTCY07A7.19), len: 140 aa. Hypothetical unknown protein. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2830161 | 2830583 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2513|Rv2513
VDDIAAFKLDSLPDITFTVTRAISSGGENPAGFLNFAARREQPEILGGGGRPGPVGPEAVDTPRIRGGKVPFVFRTLPGYTFYASQIEPRVGDPEGPTLLAGFGNIPETSQRSPGWIRITCTGPDDDEELEFFGFAGPES
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant