Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in peptidoglycan synthesis. Catalyzes the formation of 3->3 crosslinks between peptidoglycan subunits.
ProductProbable L,D-transpeptidase LdtB
CommentsRv2518c, (MTV009.03c), len: 408 aa. Probable ldtB, L,D-transpeptidase, highly similar to O07707|MLCL383.3 hypothetical 43.6 KDA protein from Mycobacterium leprae (407 aa), FASTA scores: opt: 2300, E(): 1.2e-130, (82.5% identity in 406 aa overlap); Q9CCU5|LPPS|ML0426 putative secreted protein from Mycobacterium leprae (404 aa), FASTA scores: opt: 2279, E(): 2.3e-129, (82.4% identity in 403 aa overlap); and Q9CB49|ML2446 possible lipoprotein from Mycobacterium leprae (441 aa), FASTA scores: opt: 736, E(): 8.4e-37, (35.6% identity in 399 aa overlap). Also similar to other proteins from several organisms e.g. Q9X811|SC6G10.26c putative secreted protein from Streptomyces coelicolor (424 aa), FASTA scores: opt: 867, E(): 1.1e-44, (32.25% identity in 403 aa overlap); Q9L1E8|SC3D11.14 putative lipoprotein from Streptomyces coelicolor (416 aa), FASTA scores: opt: 737, E(): 7e-37, (32.95% identity in 413 aa overlap); Q9KYV1|SCE22.11 putative lipoprotein from Streptomyces coelicolor (407 aa), FASTA scores: opt: 721, E(): 6.2e-36, (33.5% identity in 400 aa overlap). And similar to several hypothetical mycobacterial proteins e.g. Q11149|Y483_MYCTU|Rv0483|MT0501|MTCY20G9.09 (451 aa), FASTA scores: opt: 763, E(): 2.1e-38, (34.85% identity in 402 aa overlap). Has very long signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Note that previously known as lppS
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis CDC1551 ldtB|Rv2518c mutant is attenuated in BALB/c mice; mutant is more susceptible to amoxicillin-clavulanate (See Gupta et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28341092835335-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2518c|ldtB
MPKVGIAAQAGRTRVRRAWLTALMMTAVMIGAVACGSGRGPAPIKVIADKGTPFADLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA