Gene Rv2518c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in peptidoglycan synthesis. Catalyzes the formation of 3->3 crosslinks between peptidoglycan subunits. |
| Product | Probable L,D-transpeptidase LdtB |
| Comments | Rv2518c, (MTV009.03c), len: 408 aa. Probable ldtB, L,D-transpeptidase, highly similar to O07707|MLCL383.3 hypothetical 43.6 KDA protein from Mycobacterium leprae (407 aa), FASTA scores: opt: 2300, E(): 1.2e-130, (82.5% identity in 406 aa overlap); Q9CCU5|LPPS|ML0426 putative secreted protein from Mycobacterium leprae (404 aa), FASTA scores: opt: 2279, E(): 2.3e-129, (82.4% identity in 403 aa overlap); and Q9CB49|ML2446 possible lipoprotein from Mycobacterium leprae (441 aa), FASTA scores: opt: 736, E(): 8.4e-37, (35.6% identity in 399 aa overlap). Also similar to other proteins from several organisms e.g. Q9X811|SC6G10.26c putative secreted protein from Streptomyces coelicolor (424 aa), FASTA scores: opt: 867, E(): 1.1e-44, (32.25% identity in 403 aa overlap); Q9L1E8|SC3D11.14 putative lipoprotein from Streptomyces coelicolor (416 aa), FASTA scores: opt: 737, E(): 7e-37, (32.95% identity in 413 aa overlap); Q9KYV1|SCE22.11 putative lipoprotein from Streptomyces coelicolor (407 aa), FASTA scores: opt: 721, E(): 6.2e-36, (33.5% identity in 400 aa overlap). And similar to several hypothetical mycobacterial proteins e.g. Q11149|Y483_MYCTU|Rv0483|MT0501|MTCY20G9.09 (451 aa), FASTA scores: opt: 763, E(): 2.1e-38, (34.85% identity in 402 aa overlap). Has very long signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Note that previously known as lppS |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis CDC1551 ldtB|Rv2518c mutant is attenuated in BALB/c mice; mutant is more susceptible to amoxicillin-clavulanate (See Gupta et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2834109 | 2835335 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2518c|ldtB
MPKVGIAAQAGRTRVRRAWLTALMMTAVMIGAVACGSGRGPAPIKVIADKGTPFADLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Bibliography
- Gold B et al. [2001]. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Regulon
- Gupta R et al. [2010]. The Mycobacterium tuberculosis protein LdtMt2 is a nonclassical transpeptidase required for virulence and resistance to amoxicillin. Function Product
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant