Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown. Possible role in biosynthesis of the cell wall.
ProductConserved hypothetical protein. Secreted; predicted to be a substrate of the twin arginine translocation (tat) export system.
CommentsRv2525c, (MTCY159.31), len: 240 aa. Conserved hypothetical protein, equivalent to Q9X7E1|ML1190|MLCB458.05 hypothetical 25.3 KDA protein from Mycobacterium leprae (239 aa), FASTA scores: opt: 1358, E(): 1e-75, (82.15% identity in 241 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Deletion results in enhanced susceptibility to beta-lactam antibiotics and increased virulence in vivo (See Saint-Joanis et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28498522850574-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2525c|Rv2525c
MSVSRRDVLKFAAATPGVLGLGVVASSLRAAPASAGSLGTLLDYAAGVIPASQIRAAGAVGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCYQYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYEQYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGSPKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA