Gene Rv2541
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical alanine rich protein |
| Comments | Rv2541, (MTCY159.15c), len: 135 aa. Hypothetical unknown ala-rich protein, equivalent to AAK46926|MT2615.1 hypothetical 38.9 KDA protein from Mycobacterium tuberculosis strain CDC1551 but AAK46926|MT2615.1 longer at C-terminus. Questionable ORF. Some similarity with Rv2077A from Mycobacterium tuberculosis (99 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). <EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2864427 | 2864834 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2541|Rv2541
MRRRRPPHVNAPTPCDRGDVRPPGCPASIPGVEVAGGTRARLRVTADGLQALAGRCATLAGELSAAVAPSGAVLSWQANAVAVNAAHARAGAAAAAVSARMRATAAALGQAARRYAGQDTAAAAALGAVRPWGTH
Bibliography
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
