Gene Rv2553c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved membrane protein |
| Comments | Rv2553c, (MTCY159.03), len: 417 aa. Probable conserved membrane protein, equivalent to Q9CCS8|ML0514 putative membrane protein from Mycobacterium leprae (421 aa), FASTA scores: opt: 1955, E(): 1.1e-111, (72.7% identity in 414 aa overlap). Also similar in part to various proteins e.g. Q9L9G6|NOVB NOVB protein (aminodesoxychorismate lyase) from Streptomyces sphaeroides (284 aa), FASTA scores: opt: 451, E(): 2.9e-2, (37.95% identity in 203 aa overlap); Q9EWY3|2SCG38.36 conserved hypothetical protein from Streptomyces coelicolor (253 aa), FASTA scores: opt: 419, E(): 2.3e-18, (39.2% identity in 171 aa overlap); Q9CHT3|YGCC hypothetical protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (550 aa), FASTA scores: opt: 379, E(): 1.2e-15, (23.0% identity in 417 aa overlap); O25309|HP0587 aminodeoxychorismate lyase (PABC) from Helicobacter pylori (Campylobacter pylori) (329 aa), FASTA scores: opt: 290, E(): 2e-10, (31.65% identity in 180 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2872012 | 2873265 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2553c|Rv2553c
MPDGGHRHRAQPVSVRPNRHRRTRVSRAQRRHAQQIRRRRRVAGGFALSLLVVVVVVAVVVGAKLWQTMLGFGNDYTGPGKRDIVIQIRAGDSTTAVGETLLKHGVVATVRAFVDAAHGNTAISSIQPGFYRMRTEISAASAVARLTDPHNRVGKLVIPEGRQLDDTTDMKTNVVNPGIFALISRATCVDLDGTQRCVSVADLRAAASRSTPTMLSVPRWAVGPVMELGTDHRRIEGLIAPGTFNIDPSASAETILATLISAGAVEYMKSGLVDTAKSLGLSPYDILVVASLVQQEANTQDFPKVARVIYNRLHEHRTLEFDSTVNYPLDRREVATSDTDRAQRTPWNTYMAQGLPATAICSPGVDALRAAEHPVPGDWLYFVTIDSQGTTLFTRDYQQHLANIELAKHNGVLDSAR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant