Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein
CommentsRv2553c, (MTCY159.03), len: 417 aa. Probable conserved membrane protein, equivalent to Q9CCS8|ML0514 putative membrane protein from Mycobacterium leprae (421 aa), FASTA scores: opt: 1955, E(): 1.1e-111, (72.7% identity in 414 aa overlap). Also similar in part to various proteins e.g. Q9L9G6|NOVB NOVB protein (aminodesoxychorismate lyase) from Streptomyces sphaeroides (284 aa), FASTA scores: opt: 451, E(): 2.9e-2, (37.95% identity in 203 aa overlap); Q9EWY3|2SCG38.36 conserved hypothetical protein from Streptomyces coelicolor (253 aa), FASTA scores: opt: 419, E(): 2.3e-18, (39.2% identity in 171 aa overlap); Q9CHT3|YGCC hypothetical protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (550 aa), FASTA scores: opt: 379, E(): 1.2e-15, (23.0% identity in 417 aa overlap); O25309|HP0587 aminodeoxychorismate lyase (PABC) from Helicobacter pylori (Campylobacter pylori) (329 aa), FASTA scores: opt: 290, E(): 2e-10, (31.65% identity in 180 aa overlap); etc.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28720122873265-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2553c|Rv2553c
MPDGGHRHRAQPVSVRPNRHRRTRVSRAQRRHAQQIRRRRRVAGGFALSLLVVVVVVAVVVGAKLWQTMLGFGNDYTGPGKRDIVIQIRAGDSTTAVGETLLKHGVVATVRAFVDAAHGNTAISSIQPGFYRMRTEISAASAVARLTDPHNRVGKLVIPEGRQLDDTTDMKTNVVNPGIFALISRATCVDLDGTQRCVSVADLRAAASRSTPTMLSVPRWAVGPVMELGTDHRRIEGLIAPGTFNIDPSASAETILATLISAGAVEYMKSGLVDTAKSLGLSPYDILVVASLVQQEANTQDFPKVARVIYNRLHEHRTLEFDSTVNYPLDRREVATSDTDRAQRTPWNTYMAQGLPATAICSPGVDALRAAEHPVPGDWLYFVTIDSQGTTLFTRDYQQHLANIELAKHNGVLDSAR