Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2562, (MTCY9C4.06c), len: 129 aa. Conserved hypothetical protein, highly similar, but shorter 83 aa, to downstream ORF AAK46951|RV2561|MT2638|MTCY9C4.07c conserved hypothetical protein from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 866, E(): 2.2e-54, (100.0% identity in 129 aa overlap).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28817582882147+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2562|Rv2562
VAEQKVKRNVELAGVDVILVHRMLKNEVPVSEYLFMTDVVAQCLDESVRKLATPLTHDFEGIGETSTHYIDLATSDMPPAVPDHSFFGLLWADVKFEWHALPYLLGFKKACAGFRSLGRGATEEPAEMG