Gene Mb2591
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2591, -, len: 245 aa. Similar to Rv2561 and Rv2562, len: 97 aa and 129 aa, from Mycobacterium tuberculosis strain H37Rv, (87.3% identity in 79 aa overlap and 99.2% identity in 129 aa overlap). Conserved hypothetical protein, highly similar in part (and longer 33 aa) to upstream ORF AAK46951|RV2562|MT2638|MTCY9C4.06c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (212 aa), FASTA scores: opt: 205, E(): 2e-06,(76.1% identity in 46 aa overlap). Conserved hypothetical protein, highly similar, but shorter 83 aa, to downstream ORF AAK46951|RV2561|MT2638|MTCY9C4.07c CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 866, E(): 2.2e-54, (100.0% identity in 129 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2561 and Rv2562 exist as 2 genes. In Mycobacterium bovis, a single base deletion (g-*) results in a single product which is more similar to Rv2561. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2848861 | 2849598 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2591|Mb2591
MGIQRAVLLIADIGGYTNYMHWNRKHLAHAQWTVAQLLESVIDAAKGMKLAKLEGDAAFFWAPGGNTSVLVCDRPPQMRQRFRTRREQIKKDHPCDCKSCEQRDNLSIKFVAHEGEVAEQKVKRNVELAGVDVILVHRMLKNEVPVSEYLFMTDVVAQCLDESVRKLATPLTHDFEGIGETSTHYTDLATSDMPPAVPDHSFFGLLWADVKFEWHALPYLLGFKKACAGFRSLGRGATEEPAEMG
Bibliography
No article yet recorded