Gene Rv2572c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism [catalytic activity: ATP + L-aspartate + tRNA(asp) = AMP + pyrophosphate + L-aspartyl-tRNA(asp)]. |
| Product | Probable aspartyl-tRNA synthetase AspS (aspartate--tRNA ligase) (ASPRS) (aspartic acid translase) |
| Comments | Rv2572c, (MTCY227.29), len: 596 aa. Probable aspS, aspartyl-tRNA synthetase, equivalent to P36429|SYD_MYCLE|ML0501|MLCB1259.19 aspartyl-tRNA synthetase from Mycobacterium leprae (589 aa), FASTA scores: opt: 3534, E(): 1.8e-215, (87.85% identity in 592 aa overlap). Also highly similar to many e.g. O67589|SYD_AQUAE|AQ_1677 from Aquifex aeolicus (603 aa), FASTA scores: opt: 1829, E(): 8.2e-108, (47.5% identity in 598 aa overlap); O32038|SYD_BACSU from Bacillus subtilis (592 aa), FASTA scores: opt: 1732, E(): 1.1e-101, (46.25% identity in 597 aa overlap); P21889|SYD_ECOLI|TLS|B1866 from Escherichia coli strain K12 (590 aa), FASTA scores: opt: 1588, E(): 1.3e-92, (47.35% identity in 581 aa overlap); etc. Contains PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1. Belongs to class-II aminoacyl-tRNA synthetase family. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2896013 | 2897803 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2572c|aspS
VFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
