Gene Rv2576c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv2576c, (MTCY227.25), len: 154 aa. Possible conserved membrane protein, showing similarity with Q9ZFC2 hypothetical 15.7 KDA protein from Mycobacterium sp. FM10 (146 aa), FASTA scores: opt: 235, E(): 4.1e-08, (31.35% identity in 150 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2900226 | 2900690 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2576c|Rv2576c
VPAGVGNASGSVLDMTSVRTVPSAVALVTFAGAALSGVIPAIARADPVGHQVTYTVTTTSDLMANIRYMSADPPSMAAFNADSSKYMITLHTPIAGGQPLVYTATLANPSQWAIVTASGGLRVNPEFHCEIVVDGQVVVSQDGGSGVQCSTRPW
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
