Gene Rv2578c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2578c, (MTCY227.23), len: 340 aa. Conserved hypothetical protein, highly similar to hypothetical proteins (conserved or not) e.g. Q9ZBJ3|SC9C7.17c from Streptomyces coelicolor (348 aa), FASTA scores: opt: 998, E(): 1.6e-55, (47.6% identity in 355 aa overlap); Q9I763|PA0069 from Pseudomonas aeruginosa (352 aa), FASTA scores: opt: 560, E(): 6e-28, (36.6% identity in 284 aa overlap); Q986C9|MLL7417 from Rhizobium loti (Mesorhizobium loti) (356 aa), FASTA scores: opt: 550, E(): 2.6e-27, (39.15% identity in 240 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by Microarray analysis (see Davis et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2902509 | 2903531 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2578c|Rv2578c
MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAALPFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWRRETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQVPVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEHLDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSYREMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF
Bibliography
- Davis EO et al. [2002]. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. Sequence Regulation Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant