Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionGenerates a primary alcohol and halide from 1-haloalkane and H2O [catalytic activity: 1-haloalkane + H2O = a primary alcohol + halide].
ProductPossible haloalkane dehalogenase DhaA (1-chlorohexane halidohydrolase)
CommentsRv2579, (MTCY227.22c), len: 300 aa. Possible dhaA, haloalkane dehalogenase, strictly equivalent to Q9XB14|ISO-RV2579 haloalkane dehalogenase (1-chlorohexane halidohydrolase) from Mycobacterium bovis (300 aa), FASTA scores: opt: 2075, E(): 7.1e-125, (99.35% identity in 300 aa overlap); note that only two residues, 120 and 293 are different. Also highly similar to others e.g. Q9ZER0|DHAAF haloalkane dehalogenase from Mycobacterium sp strain GP1 (307 aa), FASTA scores: opt: 842, E(): 2.3e-46, (44.95% identity in 298 aa overlap); Q53042|DHAA haloalkane dehalogenase from Rhodococcus rhodochrous, and Pseudomonas pavonaceae (293 aa), FASTA scores: opt: 837, E(): 4.5e-46, (44.6% identity in 298 aa overlap); etc. Note that this protein may also be a 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase, because also highly similar to P51698|LINB_PSEPA 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase from Pseudomonas paucimobilis (Sphingomonas paucimobilis) (see Nagata et al., 1993) (296 aa), FASTA scores: opt: 1494, E(): 6.8e-88, (69.5% identity in 295 aa overlap). Also shows some similarity with proteins from Mycobacterium tuberculosis e.g. Q50670|YM96_MYCTU|Rv2296|MT2353|MTCY339.14c putative haloalkane dehalogenase (300 aa), FASTA scores: opt: 302, E(): 5.3e-12, (30.85% identity in 295 aa overlap); and Q50600|YJ33_MYCTU|Rv1833c|MT1881|MTCY1A11.10 hypothetical 32.2 KDA protein (286 aa), FASTA scores: opt: 286, E(): 5.3e-11, (29.85% identity in 288 aa overlap). May belong to alpha/beta hydrolase fold family. Note that previously known as linB.
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 3_278 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see Mattow et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by Microarray analysis (see Davis et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29036392904541+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2579|dhaA
MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV
      
Bibliography