Gene Mb2610
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE HALOALKANE DEHALOGENASE DHAA (1-CHLOROHEXANE HALIDOHYDROLASE) |
| Comments | Mb2610, dhaA, len: 300 aa. Equivalent to Rv2579,len: 300 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 300 aa overlap). Possible dhaA,haloalkane dehalogenase (EC 3.8.1.5), strictly equivalent to Q9XB14|ISO-RV2579 HALOALKANE DEHALOGENASE (1-chlorohexane halidohydrolase) (EC 3.8.1.5) from Mycobacterium bovis (300 aa), FASTA scores: opt: 2075,E(): 7.1e-125, (99.35% identity in 300 aa overlap); note that only two residues, 120 and 293 are different. Also highly similar to others e.g. Q9ZER0|DHAAF HALOALKANE DEHALOGENASE from Mycobacterium sp strain GP1 (307 aa),FASTA scores: opt: 842, E(): 2.3e-46, (44.95% identity in 298 aa overlap); Q53042|DHAA HALOALKANE DEHALOGENASE from Rhodococcus rhodochrous, and Pseudomonas pavonaceae (293 aa), FASTA scores: opt: 837, E(): 4.5e-46, (44.6% identity in 298 aa overlap); etc. Note that this protein may also be a 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase (EC 3.8.1.-), because also highly similar to P51698|LINB_PSEPA 1,3,4,6-TETRACHLORO-1,4-CYCLOHEXADIENE HYDROLASE from Pseudomonas paucimobilis (Sphingomonas paucimobilis) (see first citation below) (296 aa), FASTA scores: opt: 1494,E(): 6.8e-88, (69.5% identity in 295 aa overlap). Also shows some similarity with proteins from Mycobacterium tuberculosis e.g. Q50670|YM96_MYCTU|Rv2296|MT2353|MTCY339.14c PUTATIVE HALOALKANE DEHALOGENASE (300 aa), FASTA scores: opt: 302,E(): 5.3e-12, (30.85% identity in 295 aa overlap); and Q50600|YJ33_MYCTU|Rv1833c|MT1881|MTCY1A11.10 HYPOTHETICAL 32.2 KDA PROTEIN (286 aa), FASTA scores: opt: 286, E(): 5.3e-11, (29.85% identity in 288 aa overlap). MAY BE BELONG TO ALPHA/BETA HYDROLASE FOLD FAMILY. Note that previously known as linB. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2871087 | 2871989 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2610|dhaA
MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLVACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDTLDLGDHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAILRQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKLFINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRQLRSAAGV
Bibliography
No article yet recorded
