Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv2600, (MTCY277.01c, MTV001.01), len: 133 aa. Probable conserved integral membrane protein, equivalent (but shorter 18 aa) to Q9K537|YQ00_MYCPA hypothetical protein RV2600 homolog from Mycobacterium paratuberculosis (151 aa), FASTA scores: opt: 543, E(): 4.2e-28, (62.9% identity in 132 aa overlap). Also some similarity with other hypothetical or membrane proteins e.g. Q9L090|SCC24.27c putative integral membrane protein from Streptomyces coelicolor (146 aa), FASTA scores: opt: 241, E(): 8.7e-09, (34.8% identity in 135 aa overlap); O58487|PH0773 hypothetical 15.0 KDA protein from Pyrococcus horikoshii (138 aa), FASTA scores: opt: 116, E(): 0.84, (34.35% identity in 96 aa overlap); etc. Equivalent to AAK46990 from Mycobacterium tuberculosis strain CDC1551 (152 aa) but shorter 19 aa.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29279902928391+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2600|Rv2600
VVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPNAVVLAATMYVALAIVTIAAIYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRFREHIDAPALHPAVFATAVMLLAVAGVIAAALS