Gene Rv2600
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv2600, (MTCY277.01c, MTV001.01), len: 133 aa. Probable conserved integral membrane protein, equivalent (but shorter 18 aa) to Q9K537|YQ00_MYCPA hypothetical protein RV2600 homolog from Mycobacterium paratuberculosis (151 aa), FASTA scores: opt: 543, E(): 4.2e-28, (62.9% identity in 132 aa overlap). Also some similarity with other hypothetical or membrane proteins e.g. Q9L090|SCC24.27c putative integral membrane protein from Streptomyces coelicolor (146 aa), FASTA scores: opt: 241, E(): 8.7e-09, (34.8% identity in 135 aa overlap); O58487|PH0773 hypothetical 15.0 KDA protein from Pyrococcus horikoshii (138 aa), FASTA scores: opt: 116, E(): 0.84, (34.35% identity in 96 aa overlap); etc. Equivalent to AAK46990 from Mycobacterium tuberculosis strain CDC1551 (152 aa) but shorter 19 aa. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2927990 | 2928391 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2600|Rv2600
VVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPNAVVLAATMYVALAIVTIAAIYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRFREHIDAPALHPAVFATAVMLLAVAGVIAAALS
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
