Gene Rv2601A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB41 |
| Comments | Rv2601A, len: 95 aa. Possible vapB41, antitoxin, part of toxin-antitoxin (TA) operon with Rv2602, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis e.g. O53811|Rv0748 conserved hypothetical protein (88 aa), FASTA scores: opt: 132, E(): 0.017, (29.25% identity in 82 aa overlap); O53218|Rv2493 (73 aa), FASTA scores: opt: 107, E(): 0.97, (33.75% identity in 83 aa overlap); and Q10799|YS71_MYCTU|Rv2871 conserved hypothetical protein from Mycobacterium tuberculosis (85 aa), FASTA scores: opt: 108, E(): 0.91, (41.00% identity in 39 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2930070 | 2930357 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2601A|vapB41
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALLDQEAQWWSGHDDAAL
Bibliography
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
