Gene Rv2606c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in the biosynthesis of pyridoxine/pyridoxal 5-phosphate biosynthesis |
| Product | Possible pyridoxine biosynthesis protein SnzP |
| Comments | Rv2606c, (MTCY01A10.27), len: 299 aa. Probable snzP, pyridoxine biosynthesis protein. Highly similar to O07145|YQ06_MYCLE|ML0450|MLCL581.12c possible pyridoxine biosynthesis protein from Mycobacterium leprae (307 aa), FASTA scores: opt: 1686, E(): 1.5e-95, (89.7% identity in 291 aa overlap). Also highly similar to several pyridoxine biosynthesis proteins and hypothetical proteins e.g. Q9L286|SCL2.13c hypothetical 32.2 KDA protein from Streptomyces coelicolor (303 aa), FASTA scores: opt: 1461, E(): 7.6e-82, (76.8% identity in 293 aa overlap); O14027|YEM4_SCHPO|SPAC29B12.04 putative stress-induced protein from Schizosaccharomyces pombe (Fission yeast) (296 aa), FASTA scores: opt: 1318, E(): 3.8e-73, (70.35% identity in 290 aa overlap); Q9UW83|PYROA protein involved in pyridoxine biosynthesis from Emericella nidulans (Aspergillus nidulans) (see citation below) (304 aa), FASTA scores: opt: 1288, E(): 2.6e-71, (67.9% identity in 302 aa overlap); etc. Contains Pfam match to entry PF01680, SOR_SNZ family. Contains PS01235 Uncharacterized protein family UPF0019 signature. Belongs to the SOR_SNZ family. Note possibly co-regulated with snoP (Rv2604c). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2933171 | 2934070 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2606c|snzP
MDPAGNPATGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSRGLGEAMVGINVDEIAVGHRLAQRGW
Bibliography
- Osmani AH et al. [1999]. The extremely conserved pyroA gene of Aspergillus nidulans is required for pyridoxine synthesis and is required indirectly for resistance to photosensitizers. Homolog Secondary Function Mutant
- Mittenhuber G [2001]. Phylogenetic analyses and comparative genomics of vitamin B6 (pyridoxine) and pyridoxal phosphate biosynthesis pathways. Homolog Review
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Gao LY et al. [2003]. Transposon mutagenesis of Mycobacterium marinum identifies a locus linking pigmentation and intracellular survival. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant