Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in the biosynthesis of pyridoxine/pyridoxal 5-phosphate biosynthesis
ProductPossible pyridoxine biosynthesis protein SnzP
CommentsRv2606c, (MTCY01A10.27), len: 299 aa. Probable snzP, pyridoxine biosynthesis protein. Highly similar to O07145|YQ06_MYCLE|ML0450|MLCL581.12c possible pyridoxine biosynthesis protein from Mycobacterium leprae (307 aa), FASTA scores: opt: 1686, E(): 1.5e-95, (89.7% identity in 291 aa overlap). Also highly similar to several pyridoxine biosynthesis proteins and hypothetical proteins e.g. Q9L286|SCL2.13c hypothetical 32.2 KDA protein from Streptomyces coelicolor (303 aa), FASTA scores: opt: 1461, E(): 7.6e-82, (76.8% identity in 293 aa overlap); O14027|YEM4_SCHPO|SPAC29B12.04 putative stress-induced protein from Schizosaccharomyces pombe (Fission yeast) (296 aa), FASTA scores: opt: 1318, E(): 3.8e-73, (70.35% identity in 290 aa overlap); Q9UW83|PYROA protein involved in pyridoxine biosynthesis from Emericella nidulans (Aspergillus nidulans) (see citation below) (304 aa), FASTA scores: opt: 1288, E(): 2.6e-71, (67.9% identity in 302 aa overlap); etc. Contains Pfam match to entry PF01680, SOR_SNZ family. Contains PS01235 Uncharacterized protein family UPF0019 signature. Belongs to the SOR_SNZ family. Note possibly co-regulated with snoP (Rv2604c).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29331712934070-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2606c|snzP
MDPAGNPATGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSRGLGEAMVGINVDEIAVGHRLAQRGW
      
Bibliography