Gene Rv2607
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biosynthesis of pyridoxine (vitamin B6) and pyridoxal phosphate. Oxidize PNP and PMP into pyridoxal 5'-phosphate (PLP)[catalytic activity: pyridoxamine 5'-phosphate + H(2)O + O(2) = pyridoxal 5'-phosphate + NH(3) + H(2)O(2)]. |
| Product | Probable pyridoxamine 5'-phosphate oxidase PdxH (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase) |
| Comments | Rv2607, (MTCY01A10.26c), len: 224 aa. Probable pdxH, pyridoxinephosphate oxidase, equivalent to O33065|PDXH_MYCLE|ML2131|MLCB57.46 pyridoxamine 5'-phosphate oxidase from Mycobacterium leprae (219 aa), FASTA scores: opt: 1038, E(): 8.3e-61, (67.1% identity in 219 aa overlap). Also similar to others e.g. Q9I4S5|PDXH|PA1049 from Pseudomonas aeruginosa (215 aa), FASTA scores: opt: 608, E(): 1.1e-32, (49.55% identity in 218 aa overlap); Q9K3V7|SCD10.19c from Streptomyces coelicolor (234 aa), FASTA scores: opt: 600, E(): 3.9e-32, (42.3% identity in 234 aa overlap); P28225|PDXH_ECOLI|B1638 from Escherichia coli strain K12 (217 aa), FASTA scores: opt: 533, E(): 8.9e-28, (40.3% identity in 216 aa overlap); etc. Contains a match to Pfam entry PF01243 Pyridoxamine 5'-phosphate oxidase. Belongs to the pyridoxamine 5'-phosphate oxidase family. Cofactor: FMN. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2934198 | 2934872 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2607|pdxH
MDDDAQMVAIDKDQLARMRGEYGPEKDGCGDLDFDWLDDGWLTLLRRWLNDAQRAGVSEPNAMVLATVADGKPVTRSVLCKILDESGVAFFTSYTSAKGEQLAVTPYASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHNRIRVANGRLERLQP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Pédelacq JD et al. [2006]. Crystal structure of a putative pyridoxine 5'-phosphate oxidase (Rv2607) from Mycobacterium tuberculosis. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant