Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the first mannosylation step in phosphatidylinositol mannoside biosynthesis (transfer of mannose residues onto PI, leading to the synthesis of phosphatidylinositol monomannoside).
ProductAlpha-mannosyltransferase PimA
CommentsRv2610c, (MTCY01A10.23), len: 378 aa. PimA, alpha-mannosyltransferase (see citations below), equivalent to O07147|MLCL581.14c|ML0452 putative glycosyltransferase from Mycobacterium leprae (374 aa), FASTA scores: opt: 2044, E(): 8.8e-118, (82.25% identity in 378 aa overlap). N-terminus (from aa 1 to 27) equivalent to Q9FY7 putative alpha-mannosyl transferase (fragment) from Mycobacterium smegmatis (27 aa), blastp scores: 57.4 bits (137), E(): 3e-8, Identities = 25/27 (92%), Positives = 27/27 (99%) (see citation below). Also highly similar to Q9L284|SCL2.15c putative sugar transferase from Streptomyces coelicolor (387 aa), FASTA scores: opt: 1222, E(): 1.8e-67, (52.95% identity in 376 aa overlap); and similar in part to various proteins e.g. Q9YA73|APE2066 long hypothetical N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein from Aeropyrum pernix (392 aa), FASTA scores: opt: 434, E(): 3e-19, (31.5% identity in 378 aa overlap); Q9UZA1|PAB0827 galactosyltransferase or LPS biosynthesis RFBU related protein from Pyrococcus abyssi (371 aa), FASTA scores: opt: 382, E(): 4.3e-16, (28.2% identity in 383 aa overlap); O26275|MTH173 LPS biosynthesis RFBU related protein from Methanothermobacter thermautotrophicus (382 aa), FASTA scores: opt: 372, E(): 1.8e-15, (28.4% identity in 391 aa overlap); etc. Shows also some similarity with O05313|Rv1212c|MTCI364.24c hypothetical 41.5 KDA protein from Mycobacterium tuberculosis (387 aa), FASTA scores: opt: 232, E(): 1.1e -07, (28.4% identity in 402 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop).
Functional categoryLipid metabolism
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29378652939001-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2610c|pimA
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS