Gene Rv2619c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2619c, (MTCY01A10.14), len: 117 aa. Conserved protein, highly similar to Q9L0F3|SCD31.14 hypothetical 11.6 KDA protein from Streptomyces coelicolor (110 aa), FASTA scores: opt: 407, E(): 2.3e-21, (55.95% identity in 109 aa overlap). Also similarity with other short bacterial hypothetical proteins e.g. Q9F8B9 hypothetical 12.4 KDA protein from Streptococcus agalactiae (112 aa), FASTA scores: opt: 143, E(): 0.0032, (32.45% identity in 74 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by proteomics (See Rosenkrands et al., 2000). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2947096 | 2947449 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2619c|Rv2619c
MESISLTSLAAEKLAEAQQTHSGRAAHTIHGGHTHELRQTVLALLAGHDLSEHDSPGEATLQVLQGHVCLTAGEDAWNGRAGDYVAIPPTRHALHAVEDSVIMLTVLKSLPDAHSGS
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
