Gene Mb2652c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2652c, -, len: 117 aa. Equivalent to Rv2619c,len: 117 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 117 aa overlap). Conserved hypothetical protein, highly similar to Q9L0F3|SCD31.14 HYPOTHETICAL 11.6 KDA PROTEIN from Streptomyces coelicolor (110 aa) , FASTA scores: opt: 407, E(): 2.3e-21, (55.95% identity in 109 aa overlap). Also similarity with other short bacterial hypothetical proteins e.g. Q9F8B9 HYPOTHETICAL 12.4 KDA PROTEIN from Streptococcus agalactiae (112 aa), FASTA scores: opt: 143, E(): 0.0032,(32.45% identity in 74 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2914562 | 2914915 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2652c|Mb2652c
MESISLTSLAAEKLAEAQQTHSGRAAHTIHGGHTHELRQTVLALLAGHDLSEHDSPGEATLQVLQGHVCLTAGEDAWNGRAGDYVAIPPTRHALHAVEDSVIMLTVLKSLPDAHSGS
Bibliography
No article yet recorded