Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2619c, (MTCY01A10.14), len: 117 aa. Conserved protein, highly similar to Q9L0F3|SCD31.14 hypothetical 11.6 KDA protein from Streptomyces coelicolor (110 aa), FASTA scores: opt: 407, E(): 2.3e-21, (55.95% identity in 109 aa overlap). Also similarity with other short bacterial hypothetical proteins e.g. Q9F8B9 hypothetical 12.4 KDA protein from Streptococcus agalactiae (112 aa), FASTA scores: opt: 143, E(): 0.0032, (32.45% identity in 74 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by proteomics (See Rosenkrands et al., 2000). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29470962947449-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2619c|Rv2619c
MESISLTSLAAEKLAEAQQTHSGRAAHTIHGGHTHELRQTVLALLAGHDLSEHDSPGEATLQVLQGHVCLTAGEDAWNGRAGDYVAIPPTRHALHAVEDSVIMLTVLKSLPDAHSGS