Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductHypoxic response protein 1 Hrp1
CommentsRv2626c, (MTCY01A10.06), len: 143 aa. Hrp1, hypoxic response protein 1, similar to CAC49670|SMB21441 putative inosine-5'-monophosphate dehydrogenase protein from Rhizobium meliloti (Sinorhizobium meliloti) (120 aa), FASTA scores: opt: 287, E(): 6.6e-12, (43.75% identity in 112 aa overlap) (has its N-terminus shorter 27 aa); AAK78655|CAC0678 CBS domains from Clostridium acetobutylicum (142 aa), FASTA scores: opt: 276, E(): 3.9e-11, (35.65% identity in 115 aa overlap); Q9K9P0|BH2605 BH2605 protein from Bacillus halodurans (142 aa), FASTA scores: opt: 276, E(): 3.9e-11, (35.65% identity in 115 aa overlap); etc. Also some similarity to P71737|Rv2406c|MTCY253.14 hypothetical 15.1 KDA protein from Mycobacterium tuberculosis (142 aa), FASTA scores: opt: 145, E(): 0.00012, (22.3% identity in 112 aa overlap). Predicted possible vaccine candidate (See Zvi et al., 2008).
Functional categoryConserved hypotheticals
ProteomicsThe product of this CDS corresponds to spot 2626c identified in cell wall by proteomics at the Statens Serum Institute (Denmark), and at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations). Identified in immunodominant fractions of M. tuberculosis H37Rv cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Also identified at the Statens Serum Institute (Denmark) under aerobic and low oxygen conditions (see Rosenkrands et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis (gene induced by hypoxia) (see Sherman et al., 2001). DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). DNA microarrays and qRT-PCR indicate regulation by MprA under physiological conditions and environmental stress (SDS and Triton X-100) (See He et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29525622952993-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2626c|hrp1
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
      
Bibliography