Gene Rv2636
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2636, (MTCY441.06), len: 225 aa. Conserved hypothetical protein, showing some similarity with various proteins: Q98FG2|MLL3789 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (239 aa), FASTA scores: opt: 304, E(): 3.7e-13, (31.55% identity in 187 aa overlap); CAC46568|SMC04451 putative chloramphenicol phosphotransferase protein from Rhizobium meliloti (Sinorhizobium meliloti) (220 aa), FASTA scores: opt: 175, E(): 0.00014, (28.0% identity in 225 aa overlap); Q56148|CPT_STRVL chloramphenicol 3-O phosphotransferase from Streptomyces violaceus (Streptomyces venezuelae) (178 aa), FASTA scores: opt: 131, E(): 0.1, (31.75% identity in 170 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). Translational start site uncertain, chosen by similarity. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2962713 | 2963390 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2636|Rv2636
VINPTRARRMRYRLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNRLRKRFLS
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
