Gene Mb2669
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2669, -, len: 225 aa. Equivalent to Rv2636, len: 225 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 225 aa overlap). Conserved hypothetical protein, showing some similarity with various proteins: Q98FG2|MLL3789 HYPOTHETICAL PROTEIN from Rhizobium loti (Mesorhizobium loti) (239 aa), FASTA scores: opt: 304, E(): 3.7e-13, (31.55% identity in 187 aa overlap); CAC46568|SMC04451 PUTATIVE CHLORAMPHENICOL PHOSPHOTRANSFERASE PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (220 aa), FASTA scores: opt: 175,E(): 0.00014, (28.0% identity in 225 aa overlap); Q56148|CPT_STRVL CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE (EC 2.7.1.-) from Streptomyces violaceus (Streptomyces venezuelae) (178 aa), FASTA scores: opt: 131, E(): 0.1,(31.75% identity in 170 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). Translational start site uncertain, chosen by similarity. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2930175 | 2930852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2669|Mb2669
MINPTRARRMRYRLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNRLRKRFLS
Bibliography
No article yet recorded