Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible transmembrane protein DedA
CommentsRv2637, (MTCY441.07), len: 218 aa. Possible dedA, transmembrane protein, equivalent to Q49642|YQ37_MYCLE|ML0467|MLCL581.27|B1177_C2_172/B1177_C1_140 hypothetical 23.1 KDA protein (potential integral membrane protein, belongs to the DedA family) from Mycobacterium leprae (214 aa), FASTA scores: opt: 1160, E(): 4.4e-64, (82.75% identity in 209 aa overlap); and O69601|Y364_MYCLE|ML0287|MLCB4.30 hypothetical protein (potential integral membrane protein) (222 aa), FASTA scores: opt: 292, E(): 6.6e-11, (32.25% identity in 189 aa overlap). Also highly similar to other membrane proteins e.g. CAC42863|SCBAC36F5.27c putative integral membrane from Streptomyces coelicolor (211 aa), FASTA scores: opt: 837, E(): 2.6e-44, (59.2% identity in 201 aa overlap); Q55705|Y232_SYNY3|SLR0232 potential integral membrane protein from Synechocystis sp. strain PCC 6803 (218 aa), FASTA scores: opt: 415, E(): 1.9e-18, (37.85% identity in 206 aa overlap); Q9RV63|DR1167 DEDA protein from Deinococcus radiodurans (200 aa); P09548|DEDA_ECOLI|B2317|Z3579|ECS3201 DEDA protein (DSG-1 protein) from Escherichia coli strains K12 and O157:H7 (219 aa), blast scores: 178, E(): 1.8e-13, Identities = 53/175 (30%); etc. Also similar to O06314|Y364_MYCTU|Rv0364|MT0380|MTCY13E10.26 hypothetical 24.5 KDA protein (potential integral membrane protein) from Mycobacterium tuberculosis (227 aa), FASTA scores: opt: 293, E(): 5.8e-11, (35.85% identity in 184 aa overlap). Belongs to the DedA family.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29635862964242+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2637|dedA
MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGAAVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRFIALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIALVIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA