Gene Rv2637
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible transmembrane protein DedA |
| Comments | Rv2637, (MTCY441.07), len: 218 aa. Possible dedA, transmembrane protein, equivalent to Q49642|YQ37_MYCLE|ML0467|MLCL581.27|B1177_C2_172/B1177_C1_140 hypothetical 23.1 KDA protein (potential integral membrane protein, belongs to the DedA family) from Mycobacterium leprae (214 aa), FASTA scores: opt: 1160, E(): 4.4e-64, (82.75% identity in 209 aa overlap); and O69601|Y364_MYCLE|ML0287|MLCB4.30 hypothetical protein (potential integral membrane protein) (222 aa), FASTA scores: opt: 292, E(): 6.6e-11, (32.25% identity in 189 aa overlap). Also highly similar to other membrane proteins e.g. CAC42863|SCBAC36F5.27c putative integral membrane from Streptomyces coelicolor (211 aa), FASTA scores: opt: 837, E(): 2.6e-44, (59.2% identity in 201 aa overlap); Q55705|Y232_SYNY3|SLR0232 potential integral membrane protein from Synechocystis sp. strain PCC 6803 (218 aa), FASTA scores: opt: 415, E(): 1.9e-18, (37.85% identity in 206 aa overlap); Q9RV63|DR1167 DEDA protein from Deinococcus radiodurans (200 aa); P09548|DEDA_ECOLI|B2317|Z3579|ECS3201 DEDA protein (DSG-1 protein) from Escherichia coli strains K12 and O157:H7 (219 aa), blast scores: 178, E(): 1.8e-13, Identities = 53/175 (30%); etc. Also similar to O06314|Y364_MYCTU|Rv0364|MT0380|MTCY13E10.26 hypothetical 24.5 KDA protein (potential integral membrane protein) from Mycobacterium tuberculosis (227 aa), FASTA scores: opt: 293, E(): 5.8e-11, (35.85% identity in 184 aa overlap). Belongs to the DedA family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2963586 | 2964242 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2637|dedA
MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGAAVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRFIALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIALVIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant