Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv2639c, (MTCY441.09c), len: 110 aa. Probable conserved integral membrane protein, highly similar to many bacterial hypothetical or membrane proteins e.g. Q9X889|YE14_STRCO|SCE15.14 potential integral membrane protein from Streptomyces coelicolor (112 aa), FASTA scores: opt: 597, E(): 3.1e-31, (73.15% identity in 108 aa overlap); Q55939|Y793_SYNY3|SLL0793 potential integral membrane protein from Synechocystis sp. strain PCC 6803 (108 aa), FASTA scores: opt: 341, E(): 4.9e-15, (51.4% identity in 109 aa overlap); O31553|YFJF_BACSU potential integral membrane protein from Bacillus subtilis (109 aa), FASTA scores: opt: 334, E(): 1.4e-14, (47.5% identity in 109 aa overlap); etc.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29650262965358-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2639c|Rv2639c
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH