Gene Rv2639c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv2639c, (MTCY441.09c), len: 110 aa. Probable conserved integral membrane protein, highly similar to many bacterial hypothetical or membrane proteins e.g. Q9X889|YE14_STRCO|SCE15.14 potential integral membrane protein from Streptomyces coelicolor (112 aa), FASTA scores: opt: 597, E(): 3.1e-31, (73.15% identity in 108 aa overlap); Q55939|Y793_SYNY3|SLL0793 potential integral membrane protein from Synechocystis sp. strain PCC 6803 (108 aa), FASTA scores: opt: 341, E(): 4.9e-15, (51.4% identity in 109 aa overlap); O31553|YFJF_BACSU potential integral membrane protein from Bacillus subtilis (109 aa), FASTA scores: opt: 334, E(): 1.4e-14, (47.5% identity in 109 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2965026 | 2965358 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2639c|Rv2639c
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
