Gene Rv2642
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (probably ArsR-family) |
| Comments | Rv2642, (MTCY441.12), len: 126 aa. Possible transcriptional regulator, arsR family, highly similar to many e.g. Q9X8X8|SCH35.28c putative transcriptional regulator from Streptomyces coelicolor (122 aa), FASTA scores: opt: 390, E(): 3.7e-19, (56.55% identity in 122 aa overlap); Q9L220|SC1A2.21 putative ArsR-family transcriptional from Streptomyces coelicolor (119 aa), FASTA scores: opt: 378, E(): 2.3e-18, (59.8% identity in 97 aa overlap); Q9L1V5|SC4A9.07 putative ArsR-family transcriptional regulator from Streptomyces coelicolor (117 aa), FASTA scores: opt: 359, E(): 4.1e-17, (56.9% identity in 116 aa overlap); P52144|ARR2_ECOLI|ARSR from Escherichia coli (117 aa), FASTA scores: opt: 202, E(): 1e-06, (39.8% identity in 88 aa overlap); etc. Also similar to downstream ORF P71939|Rv2640c|MTCY441.10c putative transcriptional regulatory protein from Mycobacterium tuberculosis (119 aa), FASTA scores: opt: 237, E(): 5e-09, (38.55% identity in 109 aa overlap); and others from Mycobacterium tuberculosis e.g. O05840|Rv2358|MTCY27.22c. Contains PS00846 Bacterial regulatory proteins, arsR family signature. Contains helix-turn-helix motif at aa 58-79 (Score 1112, +2.97 SD). Belongs to the ArsR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2966533 | 2966913 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2642|Rv2642
MSNLHPLPEVASCVVAPLVREPLNPPAAAEMAARFKALADPVRLQLLSSVASRAGGEACVCDISAGVEVSQPTISHHLKVLRDAGLLTSRRRASWVYYAVVPEALTVLSNLLSVHADAAPALGAPA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
