Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSequence integration. Integrase is necessary for integration of a phage into the host genome by site-specific recombination. In conjunction with excisionase, integrase is also necessary for excision of the prophage from the host genome.
ProductProbable integrase
CommentsRv2646, (MTCY441.16), len: 332 aa. Probable integrase, similar to others e.g. P06723|VINT_BP186|int integrase from Bacteriophage 186 (336 aa)s FASTA scores: opt: 198, E(): 6.3e-05, (30.45% identity in 138 aa overlap). Could be belong to the 'phage' integrase family.
Functional categoryInsertion seqs and phages
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29705512971549+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2646|Rv2646
VNTATRVRLARKRADRLNLKLIKNGHHFRLRDADEITLAVGHLGVVEAFLAAAKSQNKPPGPPPSLHAPPSWRRDIDDYLLNLNAAGQRPATIRLRKTVLCAAAHGLGRPPADVTAEHLLDWLGKQQHLSPEGRKTYRSTLRGFFVWAYEMDRVRDYVADSLPKVRCPKQPPRPAGDDVWQAALAKADRRIELMIRLAGEAGLRRAEAAQAHTGDLMDGGLLLVHGKGGKRRIVPISDYLAALIRDTPHGYLFPNGTGGHLTAEHVGKLVSRALPGDATMHTLRHRYATRAYRGSHNLRAVQQLLGHASIVTTERYTALCDDEVRAAAAAAW