Gene Rv2646
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sequence integration. Integrase is necessary for integration of a phage into the host genome by site-specific recombination. In conjunction with excisionase, integrase is also necessary for excision of the prophage from the host genome. |
| Product | Probable integrase |
| Comments | Rv2646, (MTCY441.16), len: 332 aa. Probable integrase, similar to others e.g. P06723|VINT_BP186|int integrase from Bacteriophage 186 (336 aa)s FASTA scores: opt: 198, E(): 6.3e-05, (30.45% identity in 138 aa overlap). Could be belong to the 'phage' integrase family. |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2970551 | 2971549 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2646|Rv2646
VNTATRVRLARKRADRLNLKLIKNGHHFRLRDADEITLAVGHLGVVEAFLAAAKSQNKPPGPPPSLHAPPSWRRDIDDYLLNLNAAGQRPATIRLRKTVLCAAAHGLGRPPADVTAEHLLDWLGKQQHLSPEGRKTYRSTLRGFFVWAYEMDRVRDYVADSLPKVRCPKQPPRPAGDDVWQAALAKADRRIELMIRLAGEAGLRRAEAAQAHTGDLMDGGLLLVHGKGGKRRIVPISDYLAALIRDTPHGYLFPNGTGGHLTAEHVGKLVSRALPGDATMHTLRHRYATRAYRGSHNLRAVQQLLGHASIVTTERYTALCDDEVRAAAAAAW
Bibliography
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
