Gene Rv2650c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible PhiRv2 prophage protein |
| Comments | Rv2650c, (MTCY441.19), len: 479 aa. Possible phiRv2 prophage protein (capsid subunit) (see citation below), highly similar to O06614|Rv1576c|MTCY336.28 probable phiRv1 phage protein from Mycobacterium tuberculosis (473 aa), FASTA scores: opt: 2782, E(): 2.8e-159, (89.1% identity in 468 aa overlap). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2973795 | 2975234 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2650c|Rv2650c
MTNEQHFADDGDIKQLSLDETRSAAKQLLDSVEGDLTGDVAQRFQALTRHAEELRAEQRRRGREAEEALRRCRAGELRVVPGAPTGGDDGDAPPGNSLRDIAFRTLDVCVRDGLMSSRAAEAAETLCRTGPPQSTSWAQRWLAATGNRDYLGAFVKRVSNPVAGHTTWTDREAAAWREAAAVAAEQRAMGLVDTAGGFLIPAALDPAILLSGDGSTNPIRQVARVVQTTSEVWRGVTSEGAEAHWYSEAQEVSDDSPTLAQPAVPSYRGSCWIPFSLEIEGDAAGFVAEVGRVLADSVEQLQAAAFVSGSGNGEPTGFVSALTGTADYTVTGAGTEAVVAADVYALQSALPPRFQSNSAFAANLSTINVLRQAETANGALKFPSLHASPPMLAGKHIWEVSNMDTVDAAVTATNYPLVLGDWKQFIITDRVGSTVELVPHVFGGNRRPTGQRGFFCWFRVGSDVLVDNAFRVLKVQTTA
Bibliography
- [2000]. Review
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
