Gene Rv2652c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable PhiRv2 prophage protein |
| Comments | Rv2652c, (MTCY441.21c), len: 208 aa. Probable phiRv2 phage protein (terminase) (see citation below), showing some similarity with AAK79859|Q97HW1|CAC1896 phage terminase-like protein (small subunit) from Clostridium acetobutylicum (151 aa), FASTA scores: opt: 155, E(): 0.012, (24.7% identity in 158 aa overlap); and Q9B019 hypothetical 17.8 KDA protein from Bacteriophage GMSE-1 (159 aa), FASTA scores: opt: 141, E(): 0.087, (27.65% identity in 159 aa overlap). Also highly similar to O06612|Rv1578c|MTCY336.26 Probable phiRV1 phage protein from Mycobacterium tuberculosis (156 aa), FASTA scores: opt: 448, E(): 1.2e-20, (48.1% identity in 156 aa overlap). Equivalent to AAK47043 from Mycobacterium tuberculosis strain CDC1551 but longer 45 aa. |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2975928 | 2976554 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2652c|Rv2652c
LPSPATARPDTATVGERVRAQVLWGVFWHHGIRDPKPGKRRVVLKMGRRGPAPAPAQLKLLGGRSPGRDSGGRRVTPPAAFERVAPECPDWLPPGAKDMWGRVVPELAALNLLKESDLGVLTSFCVAWDQLMQAVTAYREQGFIATNARSRRVTVHPAVAAARAATRDVLVLARELGCTPSAEANLAAVLAAAGDPDDDEFNPFAPDR
Bibliography
- [2000]. Review
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
