Gene Rv2654c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible PhiRv2 prophage protein |
Comments | Rv2654c, (MTCY441.23c), len: 81 aa. Hypothetical ala-rich protein, possibly phiRv2 phage protein (see citation below), similar to C-terminus of Q9HNI3|VNG2091H hypothetical protein from Halobacterium sp. strain NRC-1 (212 aa), FASTA scores: opt: 122, E(): 0.46, (43.05% identity in 79 aa overlap). |
Functional category | Insertion seqs and phages |
Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
Mutant | Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2976989 | 2977234 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2654c|Rv2654c MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Bibliography
- [2000]. Review
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome