Gene Rv2656c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible PhiRv2 prophage protein |
| Comments | Rv2656c, (MTCY441.25c), len: 130 aa. Probable phiRv2 phage protein (see Hatfull 2000), highly similar to O06607|YF83_MYCTU|Rv1583c|MT3573.2|MTCY336.21 Probable phiRV1 phage protein from Mycobacterium tuberculosis (132 aa), FASTA scores: opt: 734, E(): 2.5e-39, (81.5% identity in 131 aa overlap); and some similarity with Q982T4|MLL8506 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (204 aa), FASTA scores: opt: 104, E(): 9.7, (31.85% identity in 113 aa overlap). |
| Functional category | Insertion seqs and phages |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2978660 | 2979052 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2656c|Rv2656c
MTAVGGSPPTRRCPATEDRAPATVATPSSTDPTASRAVSWWSVHEYVAPTLAAAVEWPMAGTPAWCDLDDTDPVKWAAICDAARHWALRVETCQAASAEASRDVSAAADWPAVSREIQRRRDAYIRRVVV
Bibliography
- [2000]. Review
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
