Gene Rv2657c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable PhiRv2 prophage protein | 
| Comments | Rv2657c, (MTCY441.26c), len: 86 aa. Probable phiRv2 phage protein (excisionase) (see citation below), similar to O22001|VG36_BPMD2|36|G2 gene 36 protein (GP36) from Mycobacteriophage D29 (56 aa), FASTA scores: opt: 171, E(): 9.6e-06, (48.0% identity in 50 aa overlap); and Q05246|VG36_BPML5|36 gene 36 protein (GP36) from Mycobacteriophage L5 (56 aa), FASTA scores: opt: 169, E(): 1.3e-05, (50% identity in 50 aa overlap). Similarity suggests alternative start at 21737. Contains possible helix-turn-helix motif from aa 33 to 54 (Score 1655, +4.82 SD). | 
| Functional category | Insertion seqs and phages | 
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2979049 | 2979309 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2657c|Rv2657c
MCAFPSPSLGWTVSHETERPGMADAPPLSRRYITISEAAEYLAVTDRTVRQMIADGRLRGYRSGTRLVRLRRDEVDGAMHPFGGAA
      
    Bibliography
    - [2000]. Review
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant