Gene Rv2664
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv2664, (MTCY441.33), len: 84 aa. Hypothetical protein. Some weak similarity to nearby P71964|Rv2667|clpX'|MT2741|MTCY441.36 possible ATP-dependent protease ATP-binding subunit from Mycobacterium tuberculosis (252 aa), FASTA scores: opt: 134, E(): 0.027, (31.15% identity in 77 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2982097 | 2982351 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2664|Rv2664
VKHKTDIDEWLDTIEPNPADAHDASHLRRIIAAKEAVQTAESELRAAVNAARAAGDTWAAIGVALGITRQAAFQRFGPHSTASP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
