Gene Rv2665
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Hypothetical arginine rich protein |
| Comments | Rv2665, (MTCY441.34), len: 93 aa. Hypothetical arg-rich protein, showing some similarity to N-terminus of P71640|Rv2811|MTCY16B7.32c hypothetical 21.1 KDA protein from Mycobacterium tuberculosis (202 aa), FASTA scores: opt: 157, E(): 0.0011, (37.5% identity in 72 aa overlap); and also to part of O35132|CP2B_RAT|CYP27B1|CYP27B 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor from Rattus norvegicus (Rat) (501 aa), FASTA scores: opt: 106, E(): 5.4, (34.5% identity in 87 aa overlap). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2982699 | 2982980 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2665|Rv2665
MIVVRTAEAAEQALTEGQLVCPRRGCGDTLRRWRYGRRRHVRSLGSQVIDVRPQRVRCRRCESTHVLLPAALQPRLGRGGGGQLRPGVWCTGR
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
