Gene Rv2669
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylation, substrate unknown |
| Product | GCN5-related N-acetyltransferase |
| Comments | Rv2669, (MTCY441.38), len: 156 aa. Probable acetyltransferase. Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. Similarity to several proteins e.g. Q9A6M0|CC2073 acetyltransferase (GNAT family) from Caulobacter crescentus (178 aa), FASTA scores: opt: 242, E(): 1.2e-09, (30.9% identity in 165 aa overlap); Q99RQ8|SA2159 hypothetical protein similar to transcription repressor of sporulation, septation and degradation paiA from Staphylococcus aureus subsp. aureus N315 (171 aa), FASTA scores: opt: 214, E(): 9.8e-08, (27.5% identity in 160 aa overlap); BAB58531|SAV2369 hypothetical 20.1 KDA protein from Staphylococcus aureus subsp. aureus Mu50 (171 aa), FASTA scores: opt: 214, E(): 9.8e-08, (27.5% identity in 160 aa overlap); P21340|PAIA_BACSU|O32112 protease synthase and sporulation from Bacillus subtilis (171 aa), FASTA scores: opt: 209, E(): 2.1e-07, (22.85% identity in 162 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2985283 | 2985753 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2669|Rv2669
VTDADELAAVAARTFPLACPPAVAPEHIASFVDANLSSARFAEYLTDPRRAILTARHDGRIVGYAMLIRGDDRDVELSKLYLLPGYHGTGAAAALMHKVLATAADWGALRVWLGVNQKNQRAQRFYAKTGFKINGTRTFRLGAHHENDYVMVRELV
Bibliography
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
